Browse by organism
Total number of results for Orconectes limosus are 12
Download as  Fasta  All
NPID Sequence Length Organism Family Name PMID Peptide_REF
NP00255
PRVYGFGL
 8 Orconectes limosus Allatostatin Allatostatin A 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712
NP00256
AGPYAFGL
 8 Orconectes limosus Allatostatin Carcinustatin-8 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712
NP00257
SAGPYAFGL
 9 Orconectes limosus Allatostatin orcostatin I 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712
NP00677
RSVESSGSSSSEPLSFLSQDQSVN
 24 Orconectes limosus Arthropod CHH/MIH/GIH/VIH hormone CPRPv1 14981133#Bulau P, Meisen I, Schmitz T, Keller R, Peter-Katalinić J#Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry#Mol Cell Proteomics 2004 Jun;3(6):558-64
NP00678
RSVESSGSSSSEPLSFLSQDQSVS
 24 Orconectes limosus Arthropod CHH/MIH/GIH/VIH hormone CPRPv2 14981133#Bulau P, Meisen I, Schmitz T, Keller R, Peter-Katalinić J#Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry#Mol Cell Proteomics 2004 Jun;3(6):558-64
NP00703
RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVS
 33 Orconectes limosus Arthropod CHH/MIH/GIH/VIH hormone CHH precursor-related peptide A 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991).
NP00704
QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV
 72 Orconectes limosus Arthropod CHH/MIH/GIH/VIH hormone Crustacean hyperglycemic hormone 1800954#Kegel G., Reichwein B., Tensen C.P., Keller R.; #Amino acid sequence of crustacean hyperglycemic hormone (CHH) from the crayfish, Orconectes limosus: emergence of a novel neuropeptide family.; #Peptides 12:909-913(1991).
NP00705
RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN
 33 Orconectes limosus Arthropod CHH/MIH/GIH/VIH hormone CHH precursor-related peptide A 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991).
NP00760
NSELINAILGSPTLFGEV
 18 Orconectes limosus Arthropod PDH Pigment-dispersing hormone B 14981133#Bulau P., Meisen I., Schmitz T., Keller R., Peter-Katalinic J.; #Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry.; #Mol. Cell. Proteomics 3:558-564(2004).
NP00761
NSELINAILGSPTLMGEV
 18 Orconectes limosus Arthropod PDH Pigment-dispersing hormone C 14981133#Bulau P., Meisen I., Schmitz T., Keller R., Peter-Katalinic J.; #Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry.; #Mol. Cell. Proteomics 3:558-564(2004).
NP04383
NFDEIDRSGFGFN
 13 Orconectes limosus Orcokinin Orcokinin 1480511#Stangier J., Hilbich C., Burdzik S., Keller R.; #Orcokinin: a novel myotropic peptide from the nervous system of the crayfish, Orconectes limosus.; #Peptides 13:859-864(1992).
NP04384
FDAFTTGF
 8 Orconectes limosus Orcokinin Orcomyotropin 10952880#Dircksen H., Burdzik S., Sauter A., Keller R.; #Two orcokinins and the novel octapeptide orcomyotropin in the hindgut of the crayfish Orconectes limosus: identified myostimulatory neuropeptides originating together in neurones of the terminal abdominal ganglion.; #J. Exp. Biol. 203:2807-2818(2000).